PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g056460.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 491aa    MW: 53920.3 Da    PI: 9.8962
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g056460.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1331.3e-10354960
                        CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  9 rkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60
                        rk++N+++A  sRqRKk +++eLe+k+  + +  + L  +l+    e  +lk
  Sopim04g056460.0.1  3 RKIRNKVSAHLSRQRKKHYVKELENKFRIFHSTIQHLNANLSYAMTENITLK 54
                        9***************************999999999888876666665565 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147042.37E-13250No hitNo description
SMARTSM003380.0025259IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.1E-12357No hitNo description
SuperFamilySSF579591.62E-9357No hitNo description
PfamPF001701.6E-8356IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MDRKIRNKVS AHLSRQRKKH YVKELENKFR IFHSTIQHLN ANLSYAMTEN ITLKAQLGGN  60
GVPTQVPPPL GINPYPPPWM SYTPYYMMNR QGYQVPLVPI PKLKSQALAP APKSNKEVKK  120
KKSGVKTKKV ASVSFLGVLF FILLFGGLVP LLKDRYGDKG EPFMSGESFV SGFYEKHHGR  180
VLSIDEPVNG TGYSEKYDGK NHSSHCGQRG QGESNKQNTN KTGDEFVHVG NSSHPLVASL  240
YVPRNDKLVE IDGSLIIHSV LASEKAMAFL GSAEKKNKEA GLAVPGDMAP TIPTVHPRHY  300
RSPEVGQITL VSDENENVKS SILGWYLNGV AGPLLSSGMC TEVFQFDASS SAREAVVPVT  360
NVRDTSMEQR HNDTCLHRNR RILNGPPVSL SRPSHNISKE QTGTNGKQEN PNRNNSLSSL  420
VVSVLVDGDG DGDGIMRTKS VSRIFIVVLI DSVKYVTYSC MLPFIDSAHV AEASSKNNFV  480
DTIRSTNSPH *
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004237588.10.0PREDICTED: uncharacterized protein LOC101249453
TrEMBLK4BSU40.0K4BSU4_SOLLC; Uncharacterized protein
STRINGSolyc04g056460.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30292450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56660.17e-63basic region/leucine zipper motif protein 49